PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000059G0270
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family bZIP
Protein Properties Length: 405aa    MW: 43931.2 Da    PI: 6.9978
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000059G0270genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1322.6e-10246294553
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53 
                      kr +r   NR +A rs +R+  +i+eLe+kv+ L++e ++L  +l  l+
  PH01000059G0270 246 KRVKRVLANRQSAARSKERRMRYIAELEQKVQILQTEATTLSAQLTLLE 294
                      999***************************************9998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.2E-12242306IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.921244294IPR004827Basic-leucine zipper domain
PfamPF001701.5E-9246294IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.44E-10246294No hitNo description
Gene3DG3DSA:1.20.5.1702.2E-9246294No hitNo description
CDDcd147034.95E-22247294No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 405 aa     Download sequence    Send to blast
MSTTNELMHH HVQATVPLPT HFAAVADRGM PPAQQGSKQR AGLPPTPPAA ASFHSLHADV  60
CMVDDSVRAP GGPPPRKAHR RSCSDVPFGY FQPLPPPSSK MEAGWGLPGG GTATGHDLLN  120
AYMSMEAMDG LNNSDGDSRG SSMRTNGADS SENESEDYVG ADSQVLLWGD AVKKREGVKR  180
NAAGEPAARH ARSLSTDSLV GKLSFSANGE PSKFSLGFGS GEFTPAEMKR IMADGKLAEM  240
ALADPKRVKR VLANRQSAAR SKERRMRYIA ELEQKVQILQ TEATTLSAQL TLLEVYIHLC  300
TVQRDSSGLD KQNNQLKFRL QAMEQQAQLC DALNEALTAE VQRLKLGATE LGNTSSSSNL  360
VQQIQLRCQN HMLELHEQQQ TEQTPLYQLE QPEQNGAARN HESK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015613793.10.0PREDICTED: transcription factor RF2a-like
TrEMBLA0A0E0MA280.0A0A0E0MA28_ORYPU; Uncharacterized protein
STRINGLOC_Os10g38820.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.31e-77bZIP family protein